Semaglutide 5mg
Semaglutide 5mg is a higher-concentration format of this GLP-1 receptor agonist, designed for extended research protocols requiring larger quantities or dose-escalation studies.
As a long-acting GLP-1 analogue with an approximate half-life of 7 days, semaglutide activates incretin pathways that regulate glucose metabolism, appetite, and energy balance. The 5mg vial supports research into sustained metabolic modulation, dose-response relationships, and long-term pathway analysis.
This format is particularly relevant for research protocols studying cumulative metabolic effects, combinatorial approaches with other metabolic peptides, or investigations requiring multiple dosing over extended timeframes. Research areas span glucose homeostasis, body weight regulation, hepatic lipid metabolism, and central appetite control through hypothalamic GLP-1 receptor activation.
| SKU | ONX-SEMA-5 |
|---|---|
| Purity | 99%+ |
| Molecular weight | 4113.58 Da |
| Molecular formula | C187H291N45O59 |
| CAS number | 910463-68-2 |
| Amino-acid sequence | H-Aib-EGTFTSDVSSYLEGQAAKEFIAWLVRGRG |
| Amino-acid count | 31 |
| Appearance | White to off-white lyophilised powder |
| Solubility | Reconstitutes in bacteriostatic water |
| Storage | Store at 2–8 °C, protected from light |
| Shelf life | 36 months at 2–8 °C |
Research relevance
- Studied as a long-acting GLP-1 receptor agonist in metabolic research
- Investigated for glycaemic regulation and glucose-dependent insulin secretion
- Examined in cardiovascular-outcome research contexts
- Studied for effects on appetite and energy-balance signalling
Published references
Related research notes
References are provided for scientific background only. They describe preclinical and laboratory research and do not constitute medical, therapeutic, or efficacy claims. This product is sold strictly for research use.
What is Semaglutide?
Semaglutide 5mg is a higher-concentration format of this GLP-1 receptor agonist, designed for extended research protocols requiring larger quantities or dose-escalation studies.
As a long-acting GLP-1 analogue with an approximate half-life of 7 days, semaglutide activates incretin pathways that regulate glucose metabolism, appetite, and energy balance.
Where can a laboratory buy Semaglutide in the EU?
Onyx Peptides supplies Semaglutide for laboratory research across the European Union. We are operated by Vexio j. s. a. (IČO 54214530) in Slovakia and dispatch from within the EU, so there is no customs entry, no import duty and no border hold. Orders placed before 16:00 CET ship the same day, and shipping is free above €100.
How do I verify the batch of Semaglutide I receive?
Each vial carries a batch number. Ask us for the Certificate of Analysis of the batch currently in stock — before you order, not after — and check that the batch number on the certificate matches the one printed on the vial. The analysis is performed by Janoshik Analytical, an independent laboratory in Prague, which will confirm a report it issued if you contact them with its identifier.
How is purity verified?
Every batch is independently tested by Janoshik Analytical using HPLC and Mass Spectrometry. A batch-specific Certificate of Analysis — also covering endotoxins and heavy metals — is available on request.
How fast is delivery?
We dispatch from within the EU, same day on orders placed before 16:00 CET. EU delivery typically takes 1–3 business days.
What payment methods do you accept?
We accept SEPA bank transfer (−2 %), cryptocurrency (−5 %), cash on delivery (+€1.50). Bank-transfer orders are dispatched as soon as the payment clears; SEPA instant transfers usually arrive within seconds.
How should this be stored?
Store at 2–8 °C, protected from light. Once reconstituted, keep refrigerated and use within 30 days.
What is the intended use?
All products are supplied strictly for in-vitro laboratory and research use only. They are not for human consumption, veterinary, or clinical use.



